SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9I6H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J9I6H5
Domain Number - Region: 353-396
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0824
Family Capz alpha-1 subunit 0.037
Further Details:      
 
Domain Number - Region: 43-168
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0876
Family Apolipoprotein A-I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9I6H5
Sequence length 610
Comment (tr|J9I6H5|J9I6H5_9SPIT) Uncharacterized protein {ECO:0000313|EMBL:EJY66245.1} KW=Complete proteome; Reference proteome OX=1172189 OS=Oxytricha trifallax. GN=OXYTRI_13472 OC=Stichotrichia; Sporadotrichida; Oxytrichidae; Oxytrichinae; Oxytricha.
Sequence
MNIDFKALREKFKDIGERFEGQIQRVSDITDLVSASRKQTSSITELQAQHQLHLTSIMDQ
NKSLEERLKLQNDEVQDLSTRLKTIERVTQYQSGKKENDIDEIVDQIKDKFCPKDDLDEF
SSRFDKYREQNELRMSQVSKINPQQIETMLREFQAKIIPIEEQLRAKIDCDLFDEEIDKI
KQLLLVNSNSVGDEDERQKRLRLQQDFDNSSRSASLKSKDLQEIKVYFQKIENCEIACIN
IEKKLEKLKDLKELVLRLDENCQNIVTRTQFEEFQIICEGNKIDIKETEMIVENHENMLR
KHKEMVDEVKTLVNNPNMLRRKNTSMKTGFIDEDELQKRIKLDVEAFDKFKVGQLQEFKY
ELHSQLDAYVDKHYVNGVIDKLSKSIAQIYQALNLIQATQKDEDDGMFVKKGYQCLSCDK
NINNLNATQADFQAWQRLPLKDPQDRIARFGKGFSKILGRIQVEQQNSFLANKSRIKNRH
NIFQNNEESVGNIHTNEESHQNGKRGQSHDLSMSIFNNNEMLQQEDTQTDIINNNLFQKQ
FGAQTSRNEFKYDRASPLYLTQQKLSNITKVKHLNVKKEKQIRKVKNIVKIEMPERNEIK
SGSSSLPSII
Download sequence
Identical sequences J9I6H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]