SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9NWK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NWK5
Domain Number 1 Region: 8-212
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-76
Family Capz alpha-1 subunit 0.0000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9NWK5
Sequence length 217
Comment (tr|J9NWK5|J9NWK5_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000037550} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN= OC=Canis.
Sequence
MADFEDRVSEEEKVHTAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAPYNMD
QFTPVKIEGYEDQVYAKAIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVV
GVLKIQVHYYEDGSVQLVSHKDVQDSVTVSNEVQTAKEFIKIIEHAENEYQTAISENYQT
MSDTTYKALRWQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences J9NWK5
ENSCAFP00000037550 ENSCAFP00000037550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]