SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9YG59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9YG59
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000108
Family Tetracyclin repressor-like, N-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  J9YG59
Domain Number - Region: 72-159
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0602
Family Capz alpha-1 subunit 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9YG59
Sequence length 174
Comment (tr|J9YG59|J9YG59_LEUGJ) Transcriptional regulator {ECO:0000313|EMBL:AFS40412.1} KW=Complete proteome; Reference proteome OX=1229756 OS=Leuconostoc gelidum (strain JB7). GN=C269_04845 OC=Leuconostoc.
Sequence
MKNTKSLILNTTTKWVREKDYREISLRTLTNSIGITTGAFYKHFNNKEDLYYQVSILLSQ
ELTERLNIDITAEPTSELLKVAEQICLLFKNEPYLMEFIMLNQSNNLDTHNFMFLDAINK
LIQRVNPTENEHSNRALFIQLWSFIQGYGALIKNEITNYDHELVKYTLYKFLEK
Download sequence
Identical sequences J9YG59
WP_014947601.1.80158 gi|406599952|ref|YP_006745298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]