SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9YH69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9YH69
Domain Number 1 Region: 7-238
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.47e-73
Family Pseudouridine synthase II TruB 0.000014
Further Details:      
 
Weak hits

Sequence:  J9YH69
Domain Number - Region: 261-300
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz beta-1 subunit 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9YH69
Sequence length 302
Comment (tr|J9YH69|J9YH69_LEUGJ) tRNA-uridine isomerase {ECO:0000256|HAMAP-Rule:MF_01080} KW=Complete proteome; Reference proteome OX=1229756 OS=Leuconostoc gelidum (strain JB7). GN=C269_03900 OC=Leuconostoc.
Sequence
MQHNNNVDGLIVVNKPRGVTSFDVVAKVRRAIGQKRVGHAGTLDPNVEGVLVVALGKATK
LIDELQTRPKRYVGSIILGFATETEDLDGEVISKIDIDVPFTDAAIDTAIANLNGTIKQV
PPMFSAVKVGGKRLYEYARAGEKVERPVREALIYDYKRIGATIYENKQQHFDFEATVSKG
TYIRTLAVDTGLKLGVPATMSSLTRTMGSGITIAHATTLDDLVTIAQSELLKLIIPIKDV
LTWPTKALSDDEWFAVKNGQKIATWPASDTYLQLTYHDDVKAVYAYNKEDSVWQSRYVFT
NE
Download sequence
Identical sequences J9YH69
gi|406599763|ref|YP_006745109.1| WP_010687911.1.53407 WP_010687911.1.80158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]