SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0F5R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0F5R4
Domain Number 1 Region: 34-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-23
Family Phosphate binding protein-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K0F5R4
Sequence length 297
Comment (tr|K0F5R4|K0F5R4_9NOCA) Putative transporter substrate-binding protein {ECO:0000313|EMBL:AFU05077.1} KW=Complete proteome; Reference proteome OX=1133849 OS=Nocardia brasiliensis ATCC 700358. GN=O3I_035650 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MMLAASLRMLARIVLVATAVTAVSCGNDDQGARITVGAGDAVESVMLAEIYAGALARTGA
RTTVATGSGERADYLAALDAGRITLLGEHSGALLTHLDAHAPERTPKNVADALSKSLPEG
LVVSDIADGTDLRARVLLTTEAATHDAVQSVRDLGPSCGTRTAGVAPAAGLLTAPPAANT
VTGCAFAATIPFPDLAALRKALLDGQIQAGLLLGPPAAGTGSTDGLTILSDDDYAVRAEN
VLPLFRKGTLDQAQIKKLNYVAGELTTEELAELIRRVRDEHRDPGDVARAWLDDHAL
Download sequence
Identical sequences K0F5R4
WP_014987927.1.58666 WP_014987927.1.73442 gi|407648292|ref|YP_006812051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]