SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0FM33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0FM33
Domain Number - Region: 185-238
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0785
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K0FM33
Sequence length 291
Comment (tr|K0FM33|K0FM33_BACTU) GerZC {ECO:0000313|EMBL:AFU13138.1} KW=Complete proteome OX=1195464 OS=Bacillus thuringiensis MC28. GN=MC28_1716 OC=Bacillus cereus group.
Sequence
MTASKAEIILIGKKLAQESNWLQELDSSYRDPYATINAKVVLVDGPTEEIFKVHKPSKPS
LPSYINGVIESSIQNNQSVSSTIQQLMRERNEEGMTQTVPIIKKTKNEIDTVGIAFLNRQ
GKYLTHIPKKDVKFFNLINKSKNSGRMILHLVLPPKKSNKKPNTSILVQNATRKVDVNFQ
NGKFVFNLHINANVALIEKTNVNLIKEHYDNKKNINNLESAIQKEINKNLQNMLNEIQQN
KIDPIGLSLYARAFQYKEWKKRKGDWLQALAEAKINVKTHVKIKDTGTIRN
Download sequence
Identical sequences C2VC82 K0FM33
gi|407704952|ref|YP_006828537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]