SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0FTK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0FTK4
Domain Number - Region: 57-116
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz alpha-1 subunit 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K0FTK4
Sequence length 162
Comment (tr|K0FTK4|K0FTK4_BACTU) Group-specific protein {ECO:0000313|EMBL:AFU14699.1} KW=Complete proteome OX=1195464 OS=Bacillus thuringiensis MC28. GN=MC28_3277 OC=Bacillus cereus group.
Sequence
MRKYGIWLVLFVCVAFLVGYSVTTVLGKEELKVDRKDVFTTIQKGYETQFSIRGKHLPMN
KMIETLSPYFTDNFLQVFTDENSRSDKQSGEYLLPAKEAPFSFNSETKMAYDEEHKNLYV
YERAKSGQYQIVTLKRDQDKWKLAGYHESQELLTEIKRLQQL
Download sequence
Identical sequences A0A1D3PMB6 A0A1V6LJS3 A0A242WQ98 A0A242X6U8 A0A2I0RDK5 C2UZR4 C2VG52 J8KWG2 K0FTK4 R8LKL1
gi|407706513|ref|YP_006830098.1| gi|557620797|ref|YP_008781928.1| WP_001233803.1.100095 WP_001233803.1.100771 WP_001233803.1.11380 WP_001233803.1.13113 WP_001233803.1.13424 WP_001233803.1.2407 WP_001233803.1.24792 WP_001233803.1.24969 WP_001233803.1.24992 WP_001233803.1.30144 WP_001233803.1.37661 WP_001233803.1.42182 WP_001233803.1.42747 WP_001233803.1.42941 WP_001233803.1.4453 WP_001233803.1.46586 WP_001233803.1.474 WP_001233803.1.499 WP_001233803.1.52532 WP_001233803.1.54419 WP_001233803.1.55893 WP_001233803.1.60012 WP_001233803.1.64770 WP_001233803.1.66535 WP_001233803.1.70209 WP_001233803.1.75358 WP_001233803.1.75374 WP_001233803.1.77968 WP_001233803.1.84323 WP_001233803.1.86041 WP_001233803.1.89698 WP_001233803.1.93904 WP_001233803.1.94270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]