SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0KEL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0KEL4
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-70
Family Capz beta-1 subunit 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K0KEL4
Sequence length 264
Comment (tr|K0KEL4|K0KEL4_WICCF) F-actin-capping protein subunit beta {ECO:0000313|EMBL:CCH40667.1} KW=Complete proteome; Reference proteome OX=1206466 OS=3599 / NBRC 0793 / NRRL Y-1031) (Yeast) (Pichia ciferrii). GN=BN7_201 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Wickerhamomyces.
Sequence
MVSFVRFNPKNISTNLQKITRLNPDLTEELLSSVDVPLSISRDEEDGRKFLICDYNRDLD
SYRSPWSNKYYPKLDDEDESPFPSDKLRQLEIYANDSFDVYRDLYYEGGVSSVYFWDQED
EEDSTNDSNFAGVVLLKKSTDNEQGSWDSIHVLEVLVQGSSKATYKLTSTIILDLSNDPK
STSLSGNLIRQTEKTLPITDDQSHIVNIGTLVEEIESKLRNLLQEVYFGKTRDIVGDIRS
LQGISSSENDKLKHSELVKGLQGI
Download sequence
Identical sequences K0KEL4
XP_011277433.1.60221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]