SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0SAB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0SAB4
Domain Number - Region: 39-159
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000106
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K0SAB4
Sequence length 187
Comment (tr|K0SAB4|K0SAB4_THAOC) Uncharacterized protein {ECO:0000313|EMBL:EJK61904.1} KW=Complete proteome; Reference proteome OX=159749 OS=Thalassiosira oceanica (Marine diatom). GN=THAOC_17519 OC=Thalassiosira.
Sequence
RRELVRLVDERRWMPRRAGAGGGPVPGPSNLRRLTAGDHLLERAPPWECGDQYDRVIGFY
ESAKLIDDNLWVLYSDYYYKFEIINIDTGKGVKHFYPTNGPGDYERHCYESRISLLLTCY
GGRHGMLAAGMDSSSRHNPHGAWSGPYMSLWNISPSNPESPTNRKPVMSIDLCRPLAQDP
TERGRDA
Download sequence
Identical sequences K0SAB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]