SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0ZN86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0ZN86
Domain Number - Region: 67-203
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0212
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K0ZN86
Sequence length 434
Comment (tr|K0ZN86|K0ZN86_9STRE) Putative 5-methylcytosine restriction system,catalytic subunit {ECO:0000313|EMBL:EKA04742.1} KW=Complete proteome OX=1169675 OS=Streptococcus sp. GMD6S. GN=GMD6S_08418 OC=Streptococcus.
Sequence
MRITDNQHRIAKEDFVAEYPKLSQALLDRTLDNLSIEDSIFIFPNDLTHSPDLDKDQKIF
ETVDQEIKTGNVIGFLGCGQEKLTISSRFSDESNDHFLHYLLQKVLNINLTSLDVALSRE
DKLYQLLMYLFPKYLQAAIRKGLYKEYQRFSHNDSHVKGVIDVGNHLKRNVPFMGNVVYT
TREFTYDNPLMQLIRHTIEYIKNQKSFGVLLDSNRENVSEIVRVTPAYKLADRAKIIRIN
KIKPIRHAYFREYRKLQELCLMILSREKHGLGSQAQKVHGILFDVSWLWEEYVYTLLPKD
FIHPRNKDKTDGISVFSNRERKVFPDFYHKELKIVLDAKYKELEFTEKGINREDLFQLIS
YSYILKAEKGGLVFPSKDKVVDNEIGKLAGYGALLKKFSIQIPQNASSYRGFSEMMESSE
EIFKKNIDKEVGRN
Download sequence
Identical sequences K0ZN86 K0ZYN1 K1A940 K1AHW8
WP_001223076.1.102127 WP_001223076.1.45411 WP_001223076.1.7183 WP_001223076.1.75663 WP_001223076.1.87009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]