SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K1KYK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K1KYK9
Domain Number - Region: 5-47
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1KYK9
Sequence length 69
Comment (tr|K1KYK9|K1KYK9_9BACL) Uncharacterized protein {ECO:0000313|EMBL:EKB44937.1} KW=Complete proteome OX=1224748 OS=Solibacillus isronensis B3W22. GN=B857_02306 OC=Solibacillus.
Sequence
MIQHFSYKPLFENSQIPGWSIRFFYEQKRYVAEYYKDGSIKFFGESPAEEQKEQLEKMIH
ELMLFHVYE
Download sequence
Identical sequences A0A1A7LT33 K1KYK9
WP_008406488.1.16583 WP_008406488.1.34202 WP_008406488.1.55795 WP_008406488.1.70781 WP_008406488.1.91521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]