SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K1PYH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K1PYH5
Domain Number - Region: 89-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz alpha-1 subunit 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1PYH5
Sequence length 264
Comment (tr|K1PYH5|K1PYH5_CRAGI) Uncharacterized protein {ECO:0000313|EMBL:EKC29312.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10007968 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MAEEKKIKEEPKEEMTEIEPAKKFGFSSSEEKDEKPAFLLKPPRNEGGETYLDILKREKQ
EDKEFHKMITIQSKRRLDKNPHLVTGTFGPGMGTKSLHTKIQDLLKDYYYPENEFNRLKL
DVILAEKMKEEAEAELQQKRDVEIELQITKEELQKEEYKKLTTFNWIIENELERAEMKNT
ALEEKLTEKENELQELKDNLQENREIMKRMECEMETWIDIDYVQKSKEMEKKLAENIEKE
RNERQDLIKKNWLKKKKNSNKRMT
Download sequence
Identical sequences K1PYH5
EKC29312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]