SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1RW54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K1RW54
Domain Number - Region: 17-60
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.00262
Family Troponin I 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K1RW54
Sequence length 91
Comment (tr|K1RW54|K1RW54_9ZZZZ) Plasmid recombination protein {ECO:0000313|EMBL:EKC45785.1} OX=408170 OS=human gut metagenome. GN=OBE_16674 OC=unclassified sequences; metagenomes; organismal metagenomes.
Sequence
AWLPDVEKFSKEIGKQQAYIDSLKERIGQESDYAGRMRDEKYEQELKVQKANQKIFELQR
TNEQMGRLLSKIPPEVLEELQKNHRSRAKER
Download sequence
Identical sequences K1RW54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]