SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1W1T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K1W1T6
Domain Number - Region: 101-150
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 0.0314
Family Eukaryotic RPB5 N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1W1T6
Sequence length 189
Comment (tr|K1W1T6|K1W1T6_ARTPT) Uncharacterized protein {ECO:0000313|EMBL:EKD10815.1} KW=Complete proteome OX=459495 OS=Arthrospira platensis C1. GN=SPLC1_S050230 OC=Microcoleaceae; Arthrospira.
Sequence
MSKLLIEGLVNKLLDLTPVEKESVGNRITEALGGDPTKKAPGLPKRRGNQDGGIDGRVPV
YRKVVRMEAMLTESGREEIVSREEPVMTKVEAGITIKLEGQTFSAERLGGFKIALERENL
RDGIIITARGLSPDAAVYIEKLHKDTVFRFIAPTLGDFLSQSVPDSPIEFVCDPNQAIRS
ALQLYLDNT
Download sequence
Identical sequences K1W1T6
WP_006621129.1.46202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]