SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K1X2G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1X2G9
Domain Number 1 Region: 5-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.22e-80
Family Capz beta-1 subunit 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K1X2G9
Sequence length 284
Comment (tr|K1X2G9|K1X2G9_MARBU) F-actin capping protein beta subunit {ECO:0000313|EMBL:EKD19187.1} KW=Complete proteome; Reference proteome OX=1072389 OS=leaf spot fungus). GN=MBM_02424 OC=Helotiales; Dermateaceae; Marssonina.
Sequence
MAEIDQFDSALDLLRRLDPKHTSTHLNSLISLVPSLTEDLLSSVDQPLTIARCRKTGRDY
LLCDYNRDGDSYRSPWSGEFESPLGGSGLGGVDSEGNNDGAGEGAVPSERVRAMEVRANE
AFDVYRELYYEGGVSSVYLWNLDDGFAGVVLLKKVAAPSSKSEGSWDSIHVFEAVDRART
AHYKLTSTVILSLSTSTAELGDMDLSGNMTRQIESTLPVDDDVSHIANIGKLVEDMELKM
RNLLQEVYFGKAKDVVGDLRSLGTLSEKGREESAHREVIDSMKR
Download sequence
Identical sequences K1X2G9
XP_007290313.1.5870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]