SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K1ZLB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K1ZLB6
Domain Number - Region: 44-81
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0146
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K1ZLB6
Sequence length 86
Comment (tr|K1ZLB6|K1ZLB6_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:EKD38489.1} OX=717931 OS=groundwater metagenome. GN=ACD_75C00719G0005 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
METQKITKQVIGFQRTMFNNTCNAISVMQDNSESMMNGFLKQFPWITDDARKPINDSISM
IKESKNNYQLMVDEGFQNLAEMIDKK
Download sequence
Identical sequences K1ZLB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]