SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K2A2C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K2A2C5
Domain Number 1 Region: 46-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.07e-31
Family Tandem AAA-ATPase domain 0.018
Further Details:      
 
Weak hits

Sequence:  K2A2C5
Domain Number - Region: 747-847
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00575
Family Capz alpha-1 subunit 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K2A2C5
Sequence length 976
Comment (tr|K2A2C5|K2A2C5_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:EKD55596.1} OX=717931 OS=groundwater metagenome. GN=ACD_59C00110G0001 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MSYFSDNYNEIRYPIEDNDSSSGLRRAQIGAIHSIASHFSLINEPAIVVMPTGSGKTAVL
MMSAFVERANRILVITPSRLVRTQIKENFQTMKQLIKLKVLRENINLPKVSEIVKKPKNV
EEWENFRHFDVIIGTPNSLSPGLKNMPSPPKDLFDLILIDEAHHSPAKTWNDILETFNNA
KQILFTATPFRRDHQEIKGRFIYSYSIKEAYKDNIFSKVKYISVNPINESNDIAIAKTAA
TIFNEDRIKGFNHYLMVRTDSKKRAEELEIVYNKNTNLRLKRVDSSYSYRYVKNAIEKLR
KYELDGIICVDMLGEGFDFPNLKLASIHAPHKSLEVTLQFIGRFARTTGENLGMAKFIAV
PSELEIETKRLYEEGAVWQDLITDLSQSKIEKEKKVRQTLATFDPPNITKNFVVEDLSLY
ALYPYCHVKIFQSFKNVDITAPISLPGIEIVYRQNSLKAGTSVIITREPQAPRWSSAIEL
TGFKHELIVIFYDNTSKLLFINSSKTSDSLYDIIAAKLTDDEYKILPLYKINRVLRDLQE
ANFFNIGMKNRVLNDNTESYRIIAGSSAQDAINVSDGNLYNRGHVFSSAIDNGDKTTLGY
SSASKVWSNNSCQIPELIEWCQKLARKITSKNTVTTNSGLDIIKVGEEIINFPKDLGIIA
VDWSEEIYNKVSPPMIIFGSNSKNPISDQLFNVELKIDRNYSNQKQVRIIFKLKDLEYLV
EFSLNTKHFYTAVSEANSVIVKNSKDEFSLVEYLNNNPLNIYLSDFSRINGSEIFKTDSN
ELKDIDPNIITAIDWSNYGVDITNEVSSNPTYLQISIHDYFKEKFRNENHSVVIYDHRSG
EIADFIIINELNDNIKISLYHCKGSSDKSPGNRVEDVYEICGQTVKSRIWIKSKGELFEK
IRKRISAGSELIKGNFKILSDIQNHMATKQVNYEIILVQPGITKSGLSKSVSSILASAHD
YIKRVHGEKFSIIASF
Download sequence
Identical sequences K2A2C5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]