SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K2HGQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K2HGQ3
Domain Number - Region: 17-100
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00445
Family Capz beta-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K2HGQ3
Sequence length 124
Comment (tr|K2HGQ3|K2HGQ3_ENTNP) Uncharacterized protein {ECO:0000313|EMBL:EKE42074.1} KW=Complete proteome OX=1076696 OS=Entamoeba nuttalli (strain P19) (Amoeba). GN=ENU1_033630 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MQTMELGQFILKQEQERVVDKLTHQDIPVSTEETSKEQIICSSTEDKKNEYIRSILTKPK
KFEKSKLMNSKQKQLKNSLNGPQKLTQQSLDKINKLYFLQKVNRIKEWILTKNDGSDYPY
PFLL
Download sequence
Identical sequences K2HGQ3
XP_008855592.1.50645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]