SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K2PD60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K2PD60
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.76e-63
Family Leishmanolysin 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K2PD60
Sequence length 175
Comment (tr|K2PD60|K2PD60_TRYCR) Surface protease GP63, putative {ECO:0000313|EMBL:EKF38952.1} KW=Complete proteome; Reference proteome OX=85056 OS=Trypanosoma cruzi marinkellei. GN=MOQ_000832 OC=Schizotrypanum.
Sequence
MISEVPNVRGLPKVSVISTPKTKAMARQYHNCPTLEGVELEDEGGPDTVRSHWKKRNMRD
ELMTANVGVGLYSALTLAAFEDMGVYVANYSAAEMLWWGNNSGCGLLEKKCLTDGITEYP
DLFCNQFPRAGYRLCTYNRLSLGFCRLKRHEEALPKEYRYFADPRVGGVDLFMDR
Download sequence
Identical sequences K2PD60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]