SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3VHY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3VHY4
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-85
Family Capz alpha-1 subunit 0.00000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3VHY4
Sequence length 273
Comment (tr|K3VHY4|K3VHY4_FUSPC) Uncharacterized protein {ECO:0000313|EMBL:EKJ73794.1} KW=Complete proteome OX=1028729 OS=fungus). GN=FPSE_06031 OC=Fusarium.
Sequence
MSDIETVSSFVEGAPPGELADVIADIKSLTLETNPDIVNNLTPAFEKYNEEQFVTMKLPG
SSQPVIISAYNSLGDGRYFDVESSSSFTFDHTTQKASAVQSHMLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYILDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTISSVNGAGIVREISTTEKRYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGNGGSRR
Download sequence
Identical sequences K3VHY4
XP_009257424.1.42154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]