SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3WFG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3WFG7
Domain Number 1 Region: 5-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-73
Family Capz beta-1 subunit 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WFG7
Sequence length 292
Comment (tr|K3WFG7|K3WFG7_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T003708} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MADASDANLTACLNLMRRMPPRDIEQDLYNLTRVVPALTDELYQRVDQPLQAAIDPTNGR
KYLLCDYNRDGDSYRSPWSNQYDPAIQDDEGFYPSENLRELEIQANEIFDSYREMYYQGG
ISSVYMWDLDPGFAACFLVKKDVIDQRFVEKGSWNSIHVIEVQEMNDAAATSTNNGRGVL
KKATYRLTTTVLLAMKVNRPELGDLTLDGTLTRQTEKTLEFEDQFAHVSNMGRMVEDMEI
EMRSSMDGLYISKTREVINGMRKLQQGPSQGNAFVGELAGAVLKHGLKKAQE
Download sequence
Identical sequences K3WFG7
PYU1_T003708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]