SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3WH36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3WH36
Domain Number - Region: 114-160
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0126
Family Capz alpha-1 subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3WH36
Sequence length 174
Comment (tr|K3WH36|K3WH36_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T004277} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MQVGAGGGDVERALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVIAKQLENM
NEEIPDLLQHFACVPRLATPNPADIPLLLRTREDPEMEEDDRQLMTDKPRDKNAEALQKM
KNSHNEVVESLEETFREMSEGLMKSIRVNKYVTKTKPPSTQSHQFKFIESGSYE
Download sequence
Identical sequences K3WH36
PYU1_T004277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]