SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4AJJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4AJJ6
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily F-box domain 0.00000000288
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4AJJ6
Sequence length 351
Comment (tr|K4AJJ6|K4AJJ6_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQK89676.1, ECO:0000313|EnsemblPlants:Si039066m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_039066mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MPPRRRARLSSRPYSAVAAAEPCPRGWLAVRRSRPSKRARRVVTTIPQGDGDDDGTPLTD
EILVGIFAGLPDFSDLVRCAATCRRWCRLVSGEAAFICRAKRCWTPPSPLIRSLALGFFY
SPRHGAAPRFAATASASRRLGLRQPSLNALIQGLDDGLFDASRLVASRNGLLVVELQRRK
RERALKLCVCNPMTGEVTVLPPLGGKEIVSPFACTVLTADDYYNNDDKTCGTAPASPSPP
PCAPCHHCPCPGSEPRRRWPLHRTARRSPRRVSRTPAWPPPQPRSSRFAAPRSRIPLLLL
EIGQDTQCGAALLSHLLPDADAEASSPAPHHRAKGKAKLGRKRERGKEVGA
Download sequence
Identical sequences K4AJJ6
Si039066m|PACid:19680922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]