SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4DG08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4DG08
Domain Number 1 Region: 2-247
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-72
Family Capz beta-1 subunit 0.000000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4DG08
Sequence length 256
Comment (tr|K4DG08|K4DG08_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc12g056770.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101256266 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLLPEHSSDLLSQVDQPLQVLCDMESGKEFILCEYN
RDADSYRSPWSNKYHPPLEDAPQPSLELRKLEVEANEVFAIYRDQYYEGGISSVYMWEDE
NEGFVACFLIKKDGSKTGHGRRGYLQEGAWDAIHVIEVGPEEEEIVQYCLTSTVMLTLTT
DNESSGSFNLSGSIRRQMSMKLSVSEGHLCNMGKMIEEMEGKLRNSLDQVYFGKTNEMVC
TLRPPAELVQMKLPDT
Download sequence
Identical sequences K4DG08
XP_004252559.1.44838 XP_015060170.1.21931 Solyc12g056770.1.1 Sopim12g056770.0.1 Solyc12g056770.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]