SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4ZGC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K4ZGC6
Domain Number - Region: 20-73
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00811
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4ZGC6
Sequence length 79
Comment (tr|K4ZGC6|K4ZGC6_PAEAL) Uncharacterized protein {ECO:0000313|EMBL:EJW14075.1} KW=Complete proteome; Reference proteome OX=1206781 OS=Paenibacillus alvei DSM 29. GN=PAV_141p01810 OC=Paenibacillus.
Sequence
MAIAKCVICGCEDVREEVLHIPLKVKSTHMKSDTVPVNGSKCMQCGEQYINGKTLQKIEQ
IEKSIEEMEKSFNELAVGA
Download sequence
Identical sequences K4ZGC6
gi|491703134|ref|WP_005552502.1|NZ_AMBZ01000022 WP_005552502.1.62221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]