SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K5TGV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K5TGV7
Domain Number - Region: 117-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz alpha-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K5TGV7
Sequence length 311
Comment (tr|K5TGV7|K5TGV7_9VIBR) Uncharacterized protein {ECO:0000313|EMBL:EKM12193.1} KW=Complete proteome OX=992010 OS=Vibrio sp. HENC-01. GN=VCHENC01_2632 OC=Vibrionaceae; Vibrio.
Sequence
MKDSKFPYYFSNALSMLIPRFVYREQAKRLLSTLTEAEKQYCLERVNYYNKCEQLFSVDS
REQSYAKIGEFKKTKGWTYFFDTLQVIRYFPSEFTFNYINGDVTHIPNVPSFIKSRPIHG
DNQNSIVLKLNQIRHFKFVDDEMSYRDKKDMVAWRGVGFQPHRQKVIHAFYDHPRCNIGQ
TRPQEGQPWEKGFMSIEEQLQYKFLLCIEGNDVATNLKWAMSSNSLVIMSKPKYETWFME
GKLEAGIHYVEVKDDYSDLPEKMDYYLANEQEALAIIENAHQWVEQFKDKRKERLISLMV
ADKYFTLSQQQ
Download sequence
Identical sequences K5TGV7
WP_009698951.1.45469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]