SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K5WNQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K5WNQ6
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-79
Family Capz alpha-1 subunit 0.00000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K5WNQ6
Sequence length 297
Comment (tr|K5WNQ6|K5WNQ6_PHACS) Uncharacterized protein {ECO:0000313|EMBL:EKM51952.1} KW=Complete proteome; Reference proteome OX=650164 OS=(Peniophora carnosa). GN=PHACADRAFT_262378 OC=Agaricomycetes; Polyporales; Phanerochaetaceae; Phanerochaete.
Sequence
MDAENRIHAASKFLLQSPPGEINDVLNDVRNIISDDESLQTGILPALREYNLAQFITAEV
PGHQHQCIVSEAARVQQAGGEGDEEQQDRFWDPRSRTSFRFDHLALEASDLEPIEPDADS
EPFRLALENSSLTYLSAHFHDGVAAVFSTQGNPDRFIIQVVANKYNPSNFWSGRWRSEYI
VNLNERTLEGKILVNVHYYEQGNVQLSTSHTVSLELPQTISAENATASASKVLAIVETEE
SKYQTSLNEAYQDMGEKTFKGLRRALPMTRAKMDWDKVLGYKLGQELSASKGGFAAA
Download sequence
Identical sequences K5WNQ6
XP_007399744.1.5917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]