SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K6A4G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K6A4G1
Domain Number 1 Region: 10-79
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000436
Family Tetracyclin repressor-like, N-terminal domain 0.0086
Further Details:      
 
Weak hits

Sequence:  K6A4G1
Domain Number - Region: 63-150
Classification Level Classification E-value
Superfamily RNA-binding protein She2p 0.017
Family RNA-binding protein She2p 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K6A4G1
Sequence length 196
Comment (tr|K6A4G1|K6A4G1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EKN10573.1} KW=Complete proteome OX=999418 OS=Parabacteroides goldsteinii CL02T12C30. GN=HMPREF1076_03911 OC=Parabacteroides.
Sequence
MAKAFDDNERKLIKDKLKEGALLFIQQQGVRKTSVDELVKYANISKGAFYLFYTSKELLF
FDTIIDYHKKLEKEFLNAINKHTNNITVDTLTDIISDLLINNKPYFVSIFVNSDVEYLNR
KLPQEVLSKHVDDDVMLANELLKFIPESKSIDTKVFAGALRAAFLTILNEKTIGTDIYNE
VFKFIVRGIVQQLFKD
Download sequence
Identical sequences A0A0P0M0U9 A0A1M6M6R2 K6A4G1
WP_007656985.1.100731 WP_007656985.1.18542 WP_007656985.1.20075 WP_007656985.1.456 WP_007656985.1.84564 WP_007656985.1.98544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]