SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K6IKR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K6IKR2
Domain Number - Region: 4-52
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0262
Family Capz alpha-1 subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K6IKR2
Sequence length 54
Comment (tr|K6IKR2|K6IKR2_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:EKO79857.1} KW=Complete proteome OX=1193012 OS=Leptospira sp. Fiocruz LV3954. GN=LEP1GSC068_0609 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MNLKEFLSSIPPYEYRTVFKDALPYLAEEGYFEAIIGGSFEAFHKKIFQLLTIA
Download sequence
Identical sequences K6IKR2 M5UNY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]