SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K6UF90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K6UF90
Domain Number - Region: 24-96
Classification Level Classification E-value
Superfamily 39 kda initiator binding protein, IBP39, C-terminal domains 0.0123
Family 39 kda initiator binding protein, IBP39, C-terminal domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K6UF90
Sequence length 150
Comment (tr|K6UF90|K6UF90_9APIC) Uncharacterized protein {ECO:0000313|EMBL:GAB69686.1} KW=Complete proteome; Reference proteome OX=1120755 OS=Plasmodium cynomolgi strain B. GN=PCYB_004350 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
AQLCGKYYFEEFNKIRTTFSHYKRYINEINSIEDTILRHVALYLVENFEGHKQHLTPDGT
RYNNIDCEVLNRWLDQRKSFYTYGNNCKANERLWDEKIKPLWDKLNENNICARKEVFAKN
AYIPKELLPLTCYKYIPENYECAPPLDIFT
Download sequence
Identical sequences K6UF90
XP_004227904.1.870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]