SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K6UI35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K6UI35
Domain Number - Region: 92-139
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0759
Family Capz alpha-1 subunit 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K6UI35
Sequence length 839
Comment (tr|K6UI35|K6UI35_9APIC) Uncharacterized protein {ECO:0000313|EMBL:GAB64638.1} KW=Complete proteome; Reference proteome OX=1120755 OS=Plasmodium cynomolgi strain B. GN=PCYB_022080 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MNREKPSEGRKNVGAILHRYYGLDGGSGNGDQEQGVSVALRSNEAKLNGAKEGESHMMWK
YPKKSNQMCTEEPIDVSDSEELNQKSTDFNVSEYFKKILQKATLKDLIQKAKNIEKEIKQ
NDNFMQSVVYENYNKFMKAADTIVDLKKDFGNVKNKIGDINEQLSCIDKNSHLVNKKIGK
NYKKIKNLLQIKELLNGVHTIMSIPRRMFDLIILGDYTQSGMRIFRDLYLDSENMASIAC
YYYEEQLRRGITSNLSEHTQHGDQPTHLDRNSAEDFFNHLCENVISNEQITSSLYLILAY
GKDKKEVRNVFLWNRFAAMKYLLGEISNWGSYIREGTIKGEEGHGEGHGEDEGKDDGQDD
GKDDAEVDGEVHGLSAWTPNQSAKEKEHARHTGESAPHDEGHNRVFKTVLELAYTKWLHF
FFSMIRSYEQLFLRDFYCACDETGTQRSGRMEALGGIPRLRALMRKLSASTVDARGKAAG
ALPTSPSSRGGDASQASYDNTTVNGGNAPKRGNLPPINWQEDHLEALLSTDDDREVVELL
MRIFFKLLQDLTVDLIYMFNPPVKLVARCVGVLQEGVREAERSAERSAHNRSVNRGNTHL
SSSHLGGTNINNRGSVSPLMDEFLKRINSELLKFHVYSLCLENDRRLMSFFSLCKEKEAS
YILENKPELSHHILLSLCLVLIDLEAFYKEIPLSSTDFYFKNLINFVIIYFVFLVKFVDS
FIRYFVCVWEGRRSDGGEGATCEGATDEGATCEGATDEGATCEGATYEGTTHGDAPYEGD
PPVDKEQIFQCRNIYPPQAYHNDVVNSGEEKKKKKILGNAQPSGYTKVSHLTVANFKTS
Download sequence
Identical sequences K6UI35
XP_004220605.1.870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]