SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K6VCE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K6VCE3
Domain Number 1 Region: 3-232
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-48
Family Capz beta-1 subunit 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K6VCE3
Sequence length 283
Comment (tr|K6VCE3|K6VCE3_9APIC) F-actin capping protein beta subunit {ECO:0000313|EMBL:GAB66892.1} KW=Complete proteome; Reference proteome OX=1120755 OS=Plasmodium cynomolgi strain B. GN=PCYB_102420 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MEEAKIEAALHICNILPAHLFEETIKLLSKVDHNLTNNILINKEGPIKIKFDSQQNKHYL
GNMFNKEKDSYRSPHSNRYYPEHCPNGYIPSESLRTLEMLYNEMYDRYRKAYYIGGLSSV
YLWPNPIEEGFVACFLIKKKENYDTCTSLTWEGTHLIQKKNEMTLSASINKALETPKKVS
NVNLVKDKYFHMHNMGKMIEGIENSLRKSIEYIYLPKMNDILNSIRMDDSFSSGWNNADG
RAAQNLRAISSNIALSRGSIQDELRLKLKSRELDNGEEYSLRT
Download sequence
Identical sequences K6VCE3
XP_004222839.1.870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]