SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7G055 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G055
Domain Number 1 Region: 9-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-78
Family Capz alpha-1 subunit 0.000000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7G055
Sequence length 288
Comment (tr|K7G055|K7G055_PELSI) Uncharacterized protein {ECO:0000313|Ensembl:ENSPSIP00000013665} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN= OC=Pelodiscus.
Sequence
RMTREQPLTKHEKMMIVSSLLKQAPPEEFCEAFSDLRLLVSDDSLMCQEAASLCALYNKL
HFAPVRSKECEVLLTRHNELEENHFFDPQRQVSFKFDHVRQEPSEFQAHPQEDEMGEAWR
RALYEGLKVYVSSHYPGGLCSVFIKDTAIRKILIACIAGRLHRPSAFWNGLWKSEWTFTL
TPTSTSTQVAGTIMVQAHYFEDGNIHLTVCKDVAETLPVTTETQTTQDFVKLLEDADNEF
QGELMEEYQRMSNTHLKAFRRQLPITHSMIDWEKIVTAYTINREKENL
Download sequence
Identical sequences K7G055
ENSPSIP00000013665 ENSPSIP00000013665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]