SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7GX51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7GX51
Domain Number - Region: 217-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7GX51
Sequence length 501
Comment (tr|K7GX51|K7GX51_CAEJA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:CJA04422a} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MCNPIHNELDWIGLRCVSLHLTTVKDAKSPFRGYRFRVSLVAIFIIISLAFYQFEFVKFT
KYEDEFYSKFVEIDTVMAQDPQSLLPCNVDSWNNVTLEDISFKDVRADWKNKSLGSWQNF
EDAALRPISAFVYEHEIVVVTAKYIKFDKPLYCRYFDCNHVELHGTAFQSTMFPYSAVYC
ARRAGANHITVTRTIDEPVEFTVPIVNRVLSKPVHEISVCVGPIYGAESRWLEIVETTEH
HILMGIQHFYFTVFNQVDTYTRRLLDDYEQSGNAKVTVIQTEYKHMDWMFHMMQITDCFF
RARHHSKWILNVDIDERLVMTRMPLHSYLRTIPEDVGDISFSSKRVQRTENLPSIFTPEG
FEREVLFTKYQKTNSMSYMEMKVLLRPDKTEGLFYHWVWARYPGFRTMMIPKTVGYVRHY
RTTLPSLAANWVKSKLVTDNLRNNRLDARFEEKLMVAVVRRLKLVYEQRDMWCEEIPWWI
LRMMERSNYNCIWKVNGTRFA
Download sequence
Identical sequences K7GX51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]