SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7GX52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7GX52
Domain Number - Region: 190-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7GX52
Sequence length 474
Comment (tr|K7GX52|K7GX52_CAEJA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:CJA04422b} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTFLRGYRFRVSLVAIFIIISLAFYQFEFVKFTKYEDEFYSKFVEIDTVMAQDPQSLLPC
NVDSWNNVTLEDISFKDVRADWKNKSLGSWQNFEDAALRPISAFVYEHEIVVVTAKYIKF
DKPLYCRYFDCNHVELHGTAFQSTMFPYSAVYCARRAGANHITVTRTIDEPVEFTVPIVN
RVLSKPVHEISVCVGPIYGAESRWLEIVETTEHHILMGIQHFYFTVFNQVDTYTRRLLDD
YEQSGNAKVTVIQTEYKHMDWMFHMMQITDCFFRARHHSKWILNVDIDERLVMTRMPLHS
YLRTIPEDVGDISFSSKRVQRTENLPSIFTPEGFEREVLFTKYQKTNSMSYMEMKVLLRP
DKTEGLFYHWVWARYPGFRTMMIPKTVGYVRHYRTTLPSLAANWVKSKLVTDNLRNNRLD
ARFEEKLMVAVVRRLKLVYEQRDMWCEEIPWWILRMMERSNYNCIWKVNGTRFA
Download sequence
Identical sequences K7GX52
281687.CJA04422 CJA04422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]