SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7IR84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7IR84
Domain Number 1 Region: 10-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-108
Family Capz alpha-1 subunit 0.0000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7IR84
Sequence length 289
Comment (tr|K7IR84|K7IR84_NASVI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:NV11577-PA} KW=Complete proteome; Reference proteome OX=7425 OS=Nasonia vitripennis (Parasitic wasp). GN=LOC100123517 OC=Chalcidoidea; Pteromalidae; Pteromalinae; Nasonia.
Sequence
MAADGDVVIPDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLSNDNLLKEGACGAFAQYNK
DQLMSVKIEGSDYPVLITEYNDLGNQRFYDPRSKQSFKYDHLRKEAQDYEPYEPDATAEP
WRSALQEEMIAYTQSHYRHGSCSVFAKSQGDNVTLTACIEDHQFQPKNFWNGRWRSVWTS
SFSTSSGTAELKGSLKVQVHYYEDGNVQLVSSKEVKESLPISSEKQTAKELIRLVQESEN
DYQTAISENYQTMSDTTFKALRRQLPVMRTKIDWNKIVSYSIGKELKSQ
Download sequence
Identical sequences K7IR84
7425.XP_001607161 gi|156543923|ref|XP_001607161.1| XP_001607161.1.61660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]