SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K8ECX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K8ECX4
Domain Number - Region: 56-165
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.068
Family Capz beta-1 subunit 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8ECX4
Sequence length 432
Comment (tr|K8ECX4|K8ECX4_CARML) McrBC 5-methylcytosine restriction system component family protein {ECO:0000313|EMBL:CCO09588.2} KW=Complete proteome; Reference proteome OX=1234679 OS=Carnobacterium maltaromaticum LMA28. GN=BN424_105 OC=Carnobacterium.
Sequence
MRIQDNNSYSKSEFKKTYPKISAKLIDKTLSVLSNESNIFIFPSDFSMIDDLESSSKIIE
TINEELKFQNIAGFIGCGGENLEIHSRFSQNKDDYFLHYMLQKVLNINVVDLNTNLSMEE
QIYQFLIYAFPQYLNAAMRKGIFKQYCRIEYNNINVKGNIDIARHIKRNIPFTGKVAYSS
REYTQDNDLMQLVRHTIEYIRLSTKNGQLILNSSELMKQNISSIIFATPSFNLGNKRKVI
NANRNTPLRHAYYTEYRLLQQLCLLILTYRHHDLGGGAQNIHGILFDVSWLWEEYVNTIL
KDQFIHPRNKKSKDGISIFSDRTRTVYPDFYNNELGIVIDAKYKKLEFTSKGISREDLYQ
IIGYSYILKSKTAGVVYPSVEKTKYNEIGRLSGYGALIFKQSIQIPQQVDSYKAFITLMK
ESENKFKEQWNI
Download sequence
Identical sequences K8ECX4
WP_015075168.1.23174 WP_015075168.1.4825 gi|508605337|ref|YP_006990903.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]