SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8R0M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K8R0M2
Domain Number - Region: 51-131
Classification Level Classification E-value
Superfamily IpaD-like 0.0602
Family IpaD-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8R0M2
Sequence length 158
Comment (tr|K8R0M2|K8R0M2_9BURK) Polyhydroxyalkanoate synthesis repressor PhaR {ECO:0000313|EMBL:EKS67650.1} KW=Complete proteome; Reference proteome OX=406819 OS=Burkholderia sp. SJ98. GN=BURK_021490 OC=Burkholderiaceae; Burkholderia.
Sequence
MSDVKQLVLDQEDFKVLDAKSNDDLTRSILLQIILEEESGGLPMFSSVMLSQIIRFYGHA
MQGMMGTYLEKNIQAFIDIQQKLTEQSKGIYDGNALNPEVWSQFMNMQAPMMQGMMTSYI
EQSKNMFVQMQEQMQSQAKSMFNTFPFPTPTPSSTEKK
Download sequence
Identical sequences K8R0M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]