SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9F8F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9F8F1
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-86
Family Capz beta-1 subunit 0.0000000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9F8F1
Sequence length 266
Comment (tr|K9F8F1|K9F8F1_PEND1) F-actin capping protein beta subunit {ECO:0000313|EMBL:EKV05369.1} KW=Complete proteome OX=1170230 OS=Penicillium digitatum (strain Pd1 / CECT 20795) (Green mold). GN=PDIP_83510 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MADAQFDSALDLLRRLNPRDTKTNLQAITSIVPELTEDLLSSVDQPLEIRRCPQSNRDYL
LCDYNRDGDSYRSPWSNEFYPPLEDGTVPSERVRKLEVAANESFDVYRELYYEGGVGSVY
FWDLDDGFAGVILLKKGVTPGSQSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANKTE
ALGDMDLSGNMTRQVEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSLGPLSDANRDRETQREMIMSMQK
Download sequence
Identical sequences K9F8F1 K9GKE3
XP_014532507.1.68967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]