SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9FQJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9FQJ7
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-83
Family Capz alpha-1 subunit 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9FQJ7
Sequence length 274
Comment (tr|K9FQJ7|K9FQJ7_PEND2) F-actin capping protein alpha subunit, putative {ECO:0000313|EMBL:EKV05018.1} KW=Complete proteome; Reference proteome OX=1170229 OS=Penicillium digitatum (strain PHI26 / CECT 20796) (Green mold). GN=PDIG_85850 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MASTVELASSFIEGAPPGELADVVADVQALTSEGEDIIPSLLPAFKRYNETQLATVKLPG
SSQEVVVSGFNELEDNRYFDPESQTSFEVDHTTQTASEAQSYALESEHAELIKSLLKSFG
VHAREHYPNSSYGVYPIENDSAVAIVLVANRYSPNNFWNGRFRAIYQFPVSSSSSTLTGN
IHVDVHYYEDGNVALNATKPINISIPSVSAESIVSRVAAAERDYQETLNRAFVQTSEGVF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences K9FQJ7 K9FXD5
XP_014534523.1.68967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]