SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9T2K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9T2K2
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 7.19e-22
Family ADP-ribosylglycohydrolase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9T2K2
Sequence length 314
Comment (tr|K9T2K2|K9T2K2_9CYAN) ADP-ribosylglycohydrolase {ECO:0000313|EMBL:AFY77112.1} KW=Complete proteome; Reference proteome OX=118163 OS=Pleurocapsa sp. PCC 7327. GN=Ple7327_1759 OC=Bacteria; Cyanobacteria; Pleurocapsales; Hyellaceae; Pleurocapsa.
Sequence
MRYSLLSRFQGGLLGGFLGEILIGSSSKREGMIVSEIGIDSIEPWLASGTLSAEDWEQIG
ARLSTTLEGKTPTNGGELAVAALPILFFFHDDLGLLKEQLQHLVNIWQLSAQTLEDVLIW
AYAIALALREKLDPDRLLSQILARYRLAQTPLMDQLEQVRTWLEQGTSLRQAIAQISKGG
KPNPIVLALYCFARTPEDFRLCLMQAIRTGKQASLVAALTGALAGAHNSFSGIPIDWRVA
VGKHPTGQKLTREVTCLFAAWSGAYRLEGLDTLESAAVTSPLVMQPRSSLKIISQGEYSF
LDPLFNVDSKVIKK
Download sequence
Identical sequences K9T2K2
gi|428202080|ref|YP_007080669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]