SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9UZG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9UZG1
Domain Number - Region: 7-63
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0288
Family MukF C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9UZG1
Sequence length 78
Comment (tr|K9UZG1|K9UZG1_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ00522.1} KW=Complete proteome; Reference proteome OX=1170562 OS=Calothrix sp. PCC 6303. GN=Cal6303_1473 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MNYPIPDNPQEIFDLRQKPIDEELVAAAIAGVIKVVRDQGQSLEELKSQILADDSLLDRQ
QRRWLTSVVSQAWHSFAP
Download sequence
Identical sequences K9UZG1
gi|428298188|ref|YP_007136494.1| WP_015197171.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]