SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YHJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9YHJ9
Domain Number - Region: 378-419
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz beta-1 subunit 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YHJ9
Sequence length 467
Comment (tr|K9YHJ9|K9YHJ9_CYASC) UPF0061 protein Cyast_0461 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome; Reference proteome OX=292563 OS=Cyanobacterium stanieri (strain ATCC 29140 / PCC 7202). GN=Cyast_0461 OC=Cyanobacteriaceae; Cyanobacterium.
Sequence
MTNPFLNLEYEPAMENLGEDYYDIVIPAEFPQHILRFANQALLAKIGINADSVQESHWIE
AFGKFQGLCPPLALRYHGYQFGQYNPFLGDGRGFLYGQVRGNDGKLYDFGTKGSGRTPYS
RTADGRLTLKGGVREVIAGETLHRLGVNTSRCFCLIETGESLWRGDEPSPTRSSVMVRFS
HSHIRFGSFERLHYIDRSDLIRNLLDHVIYYYYPHLCEQENPYQQFYRELVERVAKLSAQ
WMGAGFCHGVLNTDNMSITGESFDYGPYAFINTYDPKFIAAYFDYGGRYSYGNQPVICRL
NLEKLQAPLSLVMPFPELEEGLKSFDHYYEQYYQQFMLRRLGFINLSDDLGKNLVQETVD
LLKESQYGYHDFFAKLTSDFNNGWYDNYDLILENIEIKSSNLESWKILYNKALNSYQKDQ
MKSIQAILEQFNPQNIPTRPVIEEIWKPINDEDNWQLLYDFVDKIKF
Download sequence
Identical sequences K9YHJ9
gi|428772302|ref|YP_007164090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]