SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YT66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YT66
Domain Number 1 Region: 87-253
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000000000994
Family MoCo biosynthesis proteins 0.025
Further Details:      
 
Domain Number 2 Region: 4-95
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000817
Family PDZ domain 0.032
Further Details:      
 
Weak hits

Sequence:  K9YT66
Domain Number - Region: 245-295
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00497
Family Capz alpha-1 subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YT66
Sequence length 457
Comment (tr|K9YT66|K9YT66_DACSA) Putative FeS-containing Cyanobacterial-specific oxidoreductase {ECO:0000313|EMBL:AFZ49288.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_0504 OC=Dactylococcopsis.
Sequence
MIKPARISHILPDSIGEELGFEIGDAIVAINEQHPRDLIDYQYLCAEEELTLEVLDKHGE
THHIELEKDYDDNLGLEFETALFDGLIQCNNRCPFCFIDQQPPGKRESLYLKDDDYRLSF
LYGSYLTLTNLTQREWDRIAQMRLSPLYVSIHATEPEIRARLLKNPRAGQILEQLEWFQN
HRLQIHAQVVVCPDINDGRHLDQTLTDLAKFHQGDIPTVISAAVVPVGLTRFRPPEDELK
PVTMTKAKTIIQQVQQHQKQFQQELETNFAWLADEWFLIAREELPPESHYEDYPQLGNGV
GSIRQFIKEFHSIAEEMLPEAINPPRKLTWVVGNAVEIAFQPLVKQLNQVQGLTVELFPC
QSNYWGQEITVTGLLTGSDLLTKLKGRNLGEGILLPSLMLKDHDTRFLDDLTLETVSEKL
GIPIFPVTGIPELIETCLSDSLPKTILETISDLGLVY
Download sequence
Identical sequences K9YT66
gi|428778859|ref|YP_007170645.1| WP_015228301.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]