SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9Z282 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Z282
Domain Number 1 Region: 43-84,156-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000036
Family Nucleotide and nucleoside kinases 0.06
Further Details:      
 
Weak hits

Sequence:  K9Z282
Domain Number - Region: 5-147
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0785
Family Capz beta-1 subunit 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9Z282
Sequence length 329
Comment (tr|K9Z282|K9Z282_CYAAP) Uncharacterized protein {ECO:0000313|EMBL:AFZ53311.1} KW=Complete proteome; Reference proteome OX=755178 OS=Cyanobacterium aponinum (strain PCC 10605). GN=Cyan10605_1192 OC=Cyanobacteriaceae; Cyanobacterium.
Sequence
MDNKKRLIEHQKPEELEELLKYFENLFNPLEEKEISDIDLCDEPILYIMGCARSGSTLVY
QYLTESGLFTYPTNFISRFYYAPYLGAKLQQMLIEYDFREEIFTKNKTSLFTSNLGKTKG
VMSPHEFWYFWRRFFIFGDIQKLSPEVIKDVNTDKFIKDLRAFQSVKKLPLVLKGMILNW
HIPLLSSLYENSYFLFVKRDIKTNANSLVRAREKFFGDAKQWYSFKPPNYHKVINLEPIY
QTVWQVMVTNLAIETGLNSIDSTKVFTIDYEKFCQNPQSLLEELCHKWKKEMPSNMKNLP
QYFDIKKHPNISLYNWDNILSKVENLNLS
Download sequence
Identical sequences K9Z282
WP_015219040.1.72445 gi|428769565|ref|YP_007161355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]