SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0AVV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L0AVV0
Domain Number - Region: 29-97
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0068
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0AVV0
Sequence length 180
Comment (tr|L0AVV0|L0AVV0_THEEQ) Uncharacterized protein {ECO:0000313|EMBL:AFZ79363.1} KW=Complete proteome; Reference proteome OX=1537102 OS=Theileria equi strain WA. GN=BEWA_022110 OC=Theileriidae; Theileria.
Sequence
MCTCDQEVQFGSEFSSDDDLTICSRLDSDDYFSDCEDYCDCYSSNVYQESPCVCYRVINV
EAGDDAEHCIHIEDRAHSPNGANGGCQCACLVTIDQTPKTADNVPVRIRSKSQNKSKNIR
FCNRIVPKILKEPNFITFTHSLSSGLNNMEIIAKPLKPKSVKARPKKMPPKLKIAVSKRS
Download sequence
Identical sequences L0AVV0
XP_004829029.1.62149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]