SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0B1P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L0B1P7
Domain Number - Region: 74-109
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0732
Family RhoA-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L0B1P7
Sequence length 178
Comment (tr|L0B1P7|L0B1P7_THEEQ) Uncharacterized protein {ECO:0000313|EMBL:AFZ81176.1} KW=Complete proteome; Reference proteome OX=1537102 OS=Theileria equi strain WA. GN=BEWA_005840 OC=Theileriidae; Theileria.
Sequence
MYATISIVAILTIRIVICINNNAGNTFSPLAMQGMYNFFHGMTPQESTPHIAVKIMPSKR
FRISPSEMNSLLFTIKQEINHKVKELEEELYEHRYENERHLSTWALNKAPIYMPFHETTK
LKTPKYPKTLNLAMKKLHKKLGEENKADDSKSKSHIADKAMEDKVESGKTNLIPHKAS
Download sequence
Identical sequences L0B1P7
XP_004830842.1.62149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]