SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0FVK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L0FVK9
Domain Number - Region: 200-249,297-333,388-427
Classification Level Classification E-value
Superfamily TPR-like 0.000209
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Domain Number - Region: 434-520
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0201
Family Capz beta-1 subunit 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0FVK9
Sequence length 766
Comment (tr|L0FVK9|L0FVK9_ECHVK) Uncharacterized protein {ECO:0000313|EMBL:AGA77347.1} KW=Complete proteome; Reference proteome OX=926556 OS=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221). GN=Echvi_1076 OC=Echinicola.
Sequence
MKKISFLKLGLLFSGSLLLTYLVVKACGGYYDVLTSNFTPEIYVDKAYEPLLLEENFFYY
DGADEQHNGRFNDEIVEDWSEYLGTAVPKAVIDSLLLQGNTALIDTLIQRPTLTDVDLPV
WTKSIDFNDSKTRAFLTFLTLAKQVESASLNDGYWSWKPQKSTPLSDEGLFRQLQEKYEE
VSDNFLKQRYWFQVIKAYFYSASDKAKVITFFDRTATTVPKNTLYYRALAYKAGVYYQQK
DFSRSNLYYAQVFNACAPMQKVAIYSYHPQDSVVFEEETLPLAHSTAEKTTLWALQGYYT
REEVAINQIFALDPKSSHLNFLLTRLINHQERYIKDPFYNTETNRAYEDFDLYKKQQHEE
ISREALELVGKIAQSGKTDNPFLWNISHGYLLTLNDRFDAAQKVFDQAAETLPNTQLAKN
QLRLLRLINQLNKLENANPAELEALVGDLNWLYFDLPDQSYPNSGVFRYENAQRWSKQYL
SLLYAKSGNRLMSELFSNSYAGYFYQYDNQSTFFDHPKNTENLKQFLLSDQHSGIERIGE
SLYPINLEDIYFYEVIQALFANHIDEAVEIYEARGFEKEFPANPFNAHIWDNHDAEHALG
KTYPMDKFLRTLKLMQEKLDKKEAVYQNSLLLGNAFYNITHFGNVRAYQSDIVGYSYSPY
GFSPAMRQMITDCSLAKKYYQMALDAANTKEQKAKCTYMLAKCERNDYYYKKYYSQYANE
WSEENDDVDFIAWQSFQKLKEEYSDTQYYQEVIEECGYFKTYVEKE
Download sequence
Identical sequences L0FVK9
gi|431796453|ref|YP_007223357.1| WP_015264911.1.54562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]