SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0P7I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0P7I8
Domain Number 1 Region: 26-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.26e-81
Family Capz beta-1 subunit 0.0000000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L0P7I8
Sequence length 294
Comment (tr|L0P7I8|L0P7I8_PNEJ8) Uncharacterized protein {ECO:0000313|EMBL:CCJ28187.1} KW=Complete proteome; Reference proteome OX=1209962 OS=agent). GN=PNEJI1_003160 OC=Pneumocystidomycetes; Pneumocystidaceae; Pneumocystis.
Sequence
MQNSFIISHFQCILFTATHFKLLYNAQQLDAALDLFRRLPSQDITKNIAAVLEIAPDLTE
DLLASVDQPLQIKKCPKTSKLYLACDYNRDGDSYRSPWSNEYTPVLVDGIIPNEKTRKLE
IAFNEAFDIYRTLYYEGGISSVYLWDLDNGFAGVVLIKKESSKNTGYWDSIHVFEVPDTS
RTVRYRLTSTIILHMMTQNDILGQMSLSGNITRQIEQELPVDDSSSHIAHVGRLVEDMEI
KMRNILQEVYFGKTKDICNELRSISKLSQQKEGTRLQKEVVEKLSRSAEAQQKA
Download sequence
Identical sequences L0P7I8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]