SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0PFG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0PFG0
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-73
Family Capz alpha-1 subunit 0.00000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0PFG0
Sequence length 271
Comment (tr|L0PFG0|L0PFG0_PNEJ8) Uncharacterized protein {ECO:0000313|EMBL:CCJ30952.1} KW=Complete proteome; Reference proteome OX=1209962 OS=agent). GN=PNEJI1_000435 OC=Pneumocystidomycetes; Pneumocystidaceae; Pneumocystis.
Sequence
MVASIYHLIENSPPGEVNDVLNDIRILTNNDKTFFEEILPSLTKYNMEQFTNVRIPGSDS
EVTIVSKFNSNEDGWFFDPILKKSFQFDHINLKVLDVKSYETDIKVIEKITGLQKPLLAY
LSEHFPSNVNYGIFPCKNDIYNIIIVGNKYNPVNFWNGRWRSFYQFSESSLTITGTLLID
VHYYEDGNVCLTTRQTLSFEAKSLDCYDIITAIAAEEKKYQEELNTAFSGLNDYDFKSLR
RQLPMTKQKMNWENINTLKIGQDVTGRSQTY
Download sequence
Identical sequences L0PFG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]